Lineage for d3vcnc2 (3vcn C:113-403)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087392Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2087393Protein automated matches [226923] (72 species)
    not a true protein
  7. 2087494Species Caulobacter crescentus [TaxId:155892] [267903] (1 PDB entry)
  8. 2087496Domain d3vcnc2: 3vcn C:113-403 [265570]
    Other proteins in same PDB: d3vcna1, d3vcnc1
    automated match to d4il2a2
    complexed with cl, co3, gol, mg

Details for d3vcnc2

PDB Entry: 3vcn (more details), 1.45 Å

PDB Description: Crystal structure of mannonate dehydratase (target EFI-502209) from Caulobacter crescentus CB15
PDB Compounds: (C:) Mannonate dehydratase

SCOPe Domain Sequences for d3vcnc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vcnc2 c.1.11.0 (C:113-403) automated matches {Caulobacter crescentus [TaxId: 155892]}
acrtgvtvyghangetiedtiaeavkykamgykairlqtgvpglastygvskdkmfyepa
dndlpteniwstakylnsvpklferarevlgwdvhllhdvhhrltpieaarlgkdlepyr
lfwledsvpaenqagfrlirqhtttplavgeifahvwdakqlieeqlidylratvlhagg
itnlkkiaafadlhhvktgchgatdlspvtmaaalhfdmsitnfglqeymrhtpetdavf
phaytfsdgmlhpgdkpglgvdidedlaakhpykraylpvnrledgtmfnw

SCOPe Domain Coordinates for d3vcnc2:

Click to download the PDB-style file with coordinates for d3vcnc2.
(The format of our PDB-style files is described here.)

Timeline for d3vcnc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vcnc1