SCOPe 2.08: Domain d3vcna2: 3vcn A:113-403

Lineage for d3vcna2 (3vcn A:113-403)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Caulobacter crescentus [TaxId:155892] [267903] (1 PDB entry)

8. Domain d3vcna2: 3vcn A:113-403 [265568]
   Other proteins in same PDB: d3vcna1, d3vcnc1
   automated match to d4il2a2
   complexed with cl, co3, gol, mg

Details for d3vcna2

PDB Entry: 3vcn, 1.45 Å

PDB Description: Crystal structure of mannonate dehydratase (target EFI-502209) from Caulobacter crescentus CB15

PDB Compounds: (A:) Mannonate dehydratase

SCOPe Domain Sequences for d3vcna2:

Sequence; same for both SEQRES and ATOM records:

>d3vcna2 c.1.11.0 (A:113-403) automated matches {Caulobacter crescentus [TaxId: 155892]}
acrtgvtvyghangetiedtiaeavkykamgykairlqtgvpglastygvskdkmfyepa
dndlpteniwstakylnsvpklferarevlgwdvhllhdvhhrltpieaarlgkdlepyr
lfwledsvpaenqagfrlirqhtttplavgeifahvwdakqlieeqlidylratvlhagg
itnlkkiaafadlhhvktgchgatdlspvtmaaalhfdmsitnfglqeymrhtpetdavf
phaytfsdgmlhpgdkpglgvdidedlaakhpykraylpvnrledgtmfnw

Timeline for d3vcna2:

• d3vcna2 first appeared in SCOPe 2.05
  
• d3vcna2 appears in SCOPe 2.07