Lineage for d3vaxb_ (3vax B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505601Species Streptomyces lividans [TaxId:1916] [267901] (1 PDB entry)
  8. 2505603Domain d3vaxb_: 3vax B: [265566]
    automated match to d3lvja_
    complexed with plp

Details for d3vaxb_

PDB Entry: 3vax (more details), 2.4 Å

PDB Description: crystal structure of dnda from streptomyces lividans
PDB Compounds: (B:) Putative uncharacterized protein dndA

SCOPe Domain Sequences for d3vaxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vaxb_ c.67.1.0 (B:) automated matches {Streptomyces lividans [TaxId: 1916]}
tyldaaattrvdqrvadivlhwmtaefgnagsrheygirakrgverareylastvsaepd
eliftsgatesnniallglapygertgrrhiitsaiehkavleplehlagrgfevdfltp
gpsgrisvegvmerlrpdtllvslmhvnnetgviqpvaelaqqlratptylhvdaaqgyg
kvpgdlttpidmisisghkigapkgvgalvtrrreemddervplepimfgggqerklrpg
tlpvplimglaeaakifeaehaqwqvaaqdlrsrllaglastsfqvngdqdhvvphilnl
sfedvdaeaflvtlkdlvavatgsastsasftpshvlramglpeeaaskslrfswtpg

SCOPe Domain Coordinates for d3vaxb_:

Click to download the PDB-style file with coordinates for d3vaxb_.
(The format of our PDB-style files is described here.)

Timeline for d3vaxb_: