Lineage for d3v99a2 (3v99 A:115-672)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008080Fold a.119: Lipoxigenase [48483] (1 superfamily)
    multihelical
    large nearly all-alpha domain
  4. 2008081Superfamily a.119.1: Lipoxigenase [48484] (3 families) (S)
  5. 2008128Family a.119.1.0: automated matches [267626] (1 protein)
    not a true family
  6. 2008129Protein automated matches [267677] (1 species)
    not a true protein
  7. 2008130Species Human (Homo sapiens) [TaxId:9606] [267862] (4 PDB entries)
  8. 2008132Domain d3v99a2: 3v99 A:115-672 [265564]
    Other proteins in same PDB: d3v99a1
    automated match to d1loxa1
    complexed with acd, fe2

Details for d3v99a2

PDB Entry: 3v99 (more details), 2.25 Å

PDB Description: S663D Stable-5-LOX in complex with Arachidonic Acid
PDB Compounds: (A:) Arachidonate 5-lipoxygenase

SCOPe Domain Sequences for d3v99a2:

Sequence, based on SEQRES records: (download)

>d3v99a2 a.119.1.0 (A:115-672) automated matches {Human (Homo sapiens) [TaxId: 9606]}
raklarddqihilkqhrrkeletrqkqyrwmewnpgfplsidakchkdlprdiqfdsekg
vdfvlnyskamenlfinrfmhmfqsswndfadfekifvkisntiservmnhwqedlmfgy
qflnganpvlirrctelpeklpvttemvecslerqlsleqevqqgnifivdfelldgida
nktdpctlqflaapicllyknlankivpiaiqlnqipgdenpiflpsdakydwllakiwv
rssdfhvhqtithllrthlvsevfgiamyrqlpavhpifkllvahvrftiaintkareql
icecglfdkanatgggghvqmvqramkdltyaslcfpeaikargmeskedipyyfyrddg
llvweairtftaevvdiyyegdqvveedpelqdfvndvyvygmrgrkssgfpksvksreq
lseyltvviftasaqhaavnfgqydwaswipnapptmrappptakgvvtieqivdtlpdr
grscwhlgavwalsqfqenelflgmypeehfiekpvkeamarfrknleaivsviaernen
lqlpyyyldpdripnsva

Sequence, based on observed residues (ATOM records): (download)

>d3v99a2 a.119.1.0 (A:115-672) automated matches {Human (Homo sapiens) [TaxId: 9606]}
raklarddqihilkqhrrkeletrqkqyrwmewnpgfplsidakchkdlprdiqfdsfvl
nyskamenlfqsswndfadfekifvkisntiservmnhwqedlmfgyqflnganpvlirr
ctelpeklpvttemvecslerqlsleqevqqgnifivdfelldgidctlqflaapiclly
knlankivpiaiqlnqipgdenpiflpsdakydwllakiwvrssdfhvhqtithllrthl
vsevfgiamyrqlpavhpifkllvahvrftiaintkareqgghvqmvqramkdltyaslc
fpeaikargmeskedipyyfyrddgllvweairtftaevvdiyyegdqvveedpelqdfv
ndvyvygmrgrkssgfpksvksreqlseyltvviftasaqhaavnfgqydwaswipnapp
tmrappptakgvvtieqivdtlpdrgrscwhlgavwalsqfelflgmypeehfiekpvke
amarfrknleaivsviaernenlqlpyyyldpdripnsva

SCOPe Domain Coordinates for d3v99a2:

Click to download the PDB-style file with coordinates for d3v99a2.
(The format of our PDB-style files is described here.)

Timeline for d3v99a2: