SCOPe 2.06: Domain d3v99a1: 3v99 A:5-114

Lineage for d3v99a1 (3v99 A:5-114)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.0: automated matches [227174] (1 protein)
   not a true family

6. Protein automated matches [226891] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225245] (7 PDB entries)

8. Domain d3v99a1: 3v99 A:5-114 [265563]
   Other proteins in same PDB: d3v99a2
   automated match to d1loxa2
   complexed with acd, fe2

Details for d3v99a1

PDB Entry: 3v99, 2.25 Å

PDB Description: S663D Stable-5-LOX in complex with Arachidonic Acid

PDB Compounds: (A:) Arachidonate 5-lipoxygenase

SCOPe Domain Sequences for d3v99a1:

Sequence; same for both SEQRES and ATOM records:

>d3v99a1 b.12.1.0 (A:5-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sytvtvatgsqehagtddyiylslvgsagcsekhlldkgsfergavdsydvtvdeelgei
qlvriekrkygsnddwylkyitlktphgdyiefpcyrwitgdvevvlrdg

Timeline for d3v99a1:

• d3v99a1 first appeared in SCOPe 2.05
  
• d3v99a1 appears in SCOPe 2.07
  
• d3v99a1 appears in the current release, SCOPe 2.08