Lineage for d3v99a1 (3v99 A:5-114)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773710Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2773711Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2773794Family b.12.1.0: automated matches [227174] (1 protein)
    not a true family
  6. 2773795Protein automated matches [226891] (5 species)
    not a true protein
  7. 2773800Species Human (Homo sapiens) [TaxId:9606] [225245] (9 PDB entries)
  8. 2773802Domain d3v99a1: 3v99 A:5-114 [265563]
    Other proteins in same PDB: d3v99a2
    automated match to d1loxa2
    complexed with acd, fe2

Details for d3v99a1

PDB Entry: 3v99 (more details), 2.25 Å

PDB Description: S663D Stable-5-LOX in complex with Arachidonic Acid
PDB Compounds: (A:) Arachidonate 5-lipoxygenase

SCOPe Domain Sequences for d3v99a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v99a1 b.12.1.0 (A:5-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sytvtvatgsqehagtddyiylslvgsagcsekhlldkgsfergavdsydvtvdeelgei
qlvriekrkygsnddwylkyitlktphgdyiefpcyrwitgdvevvlrdg

SCOPe Domain Coordinates for d3v99a1:

Click to download the PDB-style file with coordinates for d3v99a1.
(The format of our PDB-style files is described here.)

Timeline for d3v99a1: