Class a: All alpha proteins [46456] (289 folds) |
Fold a.119: Lipoxigenase [48483] (1 superfamily) multihelical large nearly all-alpha domain |
Superfamily a.119.1: Lipoxigenase [48484] (3 families) |
Family a.119.1.0: automated matches [267626] (1 protein) not a true family |
Protein automated matches [267677] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [267862] (4 PDB entries) |
Domain d3v98a2: 3v98 A:115-673 [265562] Other proteins in same PDB: d3v98a1 automated match to d1loxa1 complexed with fe2 |
PDB Entry: 3v98 (more details), 2.07 Å
SCOPe Domain Sequences for d3v98a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v98a2 a.119.1.0 (A:115-673) automated matches {Human (Homo sapiens) [TaxId: 9606]} raklarddqihilkqhrrkeletrqkqyrwmewnpgfplsidakchkdlprdiqfdsekg vdfvlnyskamenlfinrfmhmfqsswndfadfekifvkisntiservmnhwqedlmfgy qflnganpvlirrctelpeklpvttemvecslerqlsleqevqqgnifivdfelldgida nktdpctlqflaapicllyknlankivpiaiqlnqipgdenpiflpsdakydwllakiwv rssdfhvhqtithllrthlvsevfgiamyrqlpavhpifkllvahvrftiaintkareql icecglfdkanatgggghvqmvqramkdltyaslcfpeaikargmeskedipyyfyrddg llvweairtftaevvdiyyegdqvveedpelqdfvndvyvygmrgrkssgfpksvksreq lseyltvviftasaqhaavnfgqydwaswipnapptmrappptakgvvtieqivdtlpdr grscwhlgavwalsqfqenelflgmypeehfiekpvkeamarfrknleaivsviaernen lqlpyyyldpdripnsvai
Timeline for d3v98a2: