Class b: All beta proteins [48724] (177 folds) |
Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology duplication: has weak internal pseudo twofold symmetry |
Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) |
Family b.12.1.0: automated matches [227174] (1 protein) not a true family |
Protein automated matches [226891] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225245] (7 PDB entries) |
Domain d3v98a1: 3v98 A:5-114 [265561] Other proteins in same PDB: d3v98a2 automated match to d1loxa2 complexed with fe2 |
PDB Entry: 3v98 (more details), 2.07 Å
SCOPe Domain Sequences for d3v98a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v98a1 b.12.1.0 (A:5-114) automated matches {Human (Homo sapiens) [TaxId: 9606]} sytvtvatgsqehagtddyiylslvgsagcsekhlldkgsfergavdsydvtvdeelgei qlvriekrkygsnddwylkyitlktphgdyiefpcyrwitgdvevvlrdg
Timeline for d3v98a1: