Lineage for d3v92b2 (3v92 B:115-673)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008080Fold a.119: Lipoxigenase [48483] (1 superfamily)
    multihelical
    large nearly all-alpha domain
  4. 2008081Superfamily a.119.1: Lipoxigenase [48484] (3 families) (S)
  5. 2008128Family a.119.1.0: automated matches [267626] (1 protein)
    not a true family
  6. 2008129Protein automated matches [267677] (1 species)
    not a true protein
  7. 2008130Species Human (Homo sapiens) [TaxId:9606] [267862] (4 PDB entries)
  8. 2008134Domain d3v92b2: 3v92 B:115-673 [265560]
    Other proteins in same PDB: d3v92b1
    automated match to d1loxa1
    complexed with fe2

Details for d3v92b2

PDB Entry: 3v92 (more details), 2.74 Å

PDB Description: S663A Stable-5-LOX
PDB Compounds: (B:) Arachidonate 5-lipoxygenase

SCOPe Domain Sequences for d3v92b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v92b2 a.119.1.0 (B:115-673) automated matches {Human (Homo sapiens) [TaxId: 9606]}
raklarddqihilkqhrrkeletrqkqyrwmewnpgfplsidakchkdlprdiqfdsekg
vdfvlnyskamenlfinrfmhmfqsswndfadfekifvkisntiservmnhwqedlmfgy
qflnganpvlirrctelpeklpvttemvecslerqlsleqevqqgnifivdfelldgida
nktdpctlqflaapicllyknlankivpiaiqlnqipgdenpiflpsdakydwllakiwv
rssdfhvhqtithllrthlvsevfgiamyrqlpavhpifkllvahvrftiaintkareql
icecglfdkanatgggghvqmvqramkdltyaslcfpeaikargmeskedipyyfyrddg
llvweairtftaevvdiyyegdqvveedpelqdfvndvyvygmrgrkssgfpksvksreq
lseyltvviftasaqhaavnfgqydwaswipnapptmrappptakgvvtieqivdtlpdr
grscwhlgavwalsqfqenelflgmypeehfiekpvkeamarfrknleaivsviaernen
lqlpyyylapdripnsvai

SCOPe Domain Coordinates for d3v92b2:

Click to download the PDB-style file with coordinates for d3v92b2.
(The format of our PDB-style files is described here.)

Timeline for d3v92b2: