Lineage for d3v7ia1 (3v7i A:240-389)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918300Species Streptomyces coelicolor [TaxId:1902] [267900] (1 PDB entry)
  8. 2918301Domain d3v7ia1: 3v7i A:240-389 [265558]
    Other proteins in same PDB: d3v7ia2
    automated match to d1u0ma2

Details for d3v7ia1

PDB Entry: 3v7i (more details), 2.9 Å

PDB Description: germicidin synthase (gcs) from streptomyces coelicolor, a type iii polyketide synthase
PDB Compounds: (A:) putative polyketide synthase

SCOPe Domain Sequences for d3v7ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v7ia1 c.95.1.0 (A:240-389) automated matches {Streptomyces coelicolor [TaxId: 1902]}
pesvlrldaawhhtlpgtrdlhrletradgthfvmdrrgpravqetvtamwewlrvryed
dpsswhpdvllahpggtrvleymeqtmpdewpsgllsysrdsytsgnrggaavfdilrra
hdagqktgsravlyaaapgltatalegewl

SCOPe Domain Coordinates for d3v7ia1:

Click to download the PDB-style file with coordinates for d3v7ia1.
(The format of our PDB-style files is described here.)

Timeline for d3v7ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v7ia2