![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Streptomyces coelicolor [TaxId:1902] [267900] (1 PDB entry) |
![]() | Domain d3v7ia1: 3v7i A:240-389 [265558] Other proteins in same PDB: d3v7ia2 automated match to d1u0ma2 |
PDB Entry: 3v7i (more details), 2.9 Å
SCOPe Domain Sequences for d3v7ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v7ia1 c.95.1.0 (A:240-389) automated matches {Streptomyces coelicolor [TaxId: 1902]} pesvlrldaawhhtlpgtrdlhrletradgthfvmdrrgpravqetvtamwewlrvryed dpsswhpdvllahpggtrvleymeqtmpdewpsgllsysrdsytsgnrggaavfdilrra hdagqktgsravlyaaapgltatalegewl
Timeline for d3v7ia1: