Lineage for d3v3wa2 (3v3w A:112-402)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087392Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2087393Protein automated matches [226923] (73 species)
    not a true protein
  7. 2087504Species Cellvibrio japonicus [TaxId:498211] [267899] (2 PDB entries)
  8. 2087505Domain d3v3wa2: 3v3w A:112-402 [265553]
    Other proteins in same PDB: d3v3wa1
    automated match to d4il2a2
    complexed with cl, gol, mg, nhe

Details for d3v3wa2

PDB Entry: 3v3w (more details), 1.4 Å

PDB Description: crystal structure of an enolase from the soil bacterium cellvibrio japonicus (target efi-502161) with bound mg and glycerol
PDB Compounds: (A:) Starvation sensing protein rspA

SCOPe Domain Sequences for d3v3wa2:

Sequence, based on SEQRES records: (download)

>d3v3wa2 c.1.11.0 (A:112-402) automated matches {Cellvibrio japonicus [TaxId: 498211]}
ksrerilsythangkdldstleavrkakdkgykairvqcgipgiaktygvstntksyepa
dadlpsvevwstekylnyipdvfaavrkefgpdihllhdvhhrltpieaarlgkalepyh
lfwmedavpaenqesfklirqhtttplavgevfnsihdcreliqnqwidyirttivhagg
isqmrriadfaslfhvrtgfhgatdlspvcmgaalhfdywvpnfgiqehmahseqmnavf
phaytfndgyftpgekpghgvdideklaaqypykraclpvnrledgtlwhw

Sequence, based on observed residues (ATOM records): (download)

>d3v3wa2 c.1.11.0 (A:112-402) automated matches {Cellvibrio japonicus [TaxId: 498211]}
ksrerilsythangkdldstleavrkakdkgykairvqcgipgiaktygvsyepadadlp
svevwstekylnyipdvfaavrkefgpdihllhdvhhrltpieaarlgkalepyhlfwme
davpaenqesfklirqhtttplavgevfnsihdcreliqnqwidyirttivhaggisqmr
riadfaslfhvrtgfhgatdlspvcmgaalhfdywvpnfgiqehmahseqmnavfphayt
fndgyftpgekpghgvdideklaaqypykraclpvnrledgtlwhw

SCOPe Domain Coordinates for d3v3wa2:

Click to download the PDB-style file with coordinates for d3v3wa2.
(The format of our PDB-style files is described here.)

Timeline for d3v3wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v3wa1