SCOPe 2.08: Domain d3uzoa_: 3uzo A:

Lineage for d3uzoa_ (3uzo A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
   2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8

4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families)

5. Family e.17.1.0: automated matches [191499] (1 protein)
   not a true family

6. Protein automated matches [190815] (21 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:1299] [267897] (3 PDB entries)

8. Domain d3uzoa_: 3uzo A: [265550]
   automated match to d4dqna_
   complexed with glu, plp

Details for d3uzoa_

PDB Entry: 3uzo, 2 Å

PDB Description: Crystal Structures of Branched-Chain Aminotransferase from Deinococcus radiodurans Complexes with alpha-Ketoisocaproate and L-Glutamate Suggest Its Radio-Resistance for Catalysis

PDB Compounds: (A:) branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d3uzoa_:

Sequence; same for both SEQRES and ATOM records:

>d3uzoa_ e.17.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
idwstlgfsyirtdlrylahwkdgewdagtltednqihlaegstalhygqqcfeglkayr
cadgsinlfrpdqnaarmrmscrrllmpelsdeqfidaclqvvranehflppygtggsly
lrpfvigvgdnigvrtapefifsvfcvpvgpyfkggltptnfitsdydraaphgtgaakv
ggnyaasllpgyeakkrdfadviyldpathttieeagaanffaitqdgqkfvtpqspsil
psitkysllwlaehrlgleveegdiridelgkfseagacgtaavitpiggiqhgddfhvf
ysesepgpvtrrlydelvgiqygdkeapegwivkv

Timeline for d3uzoa_:

• d3uzoa_ first appeared in SCOPe 2.05
  
• d3uzoa_ appears in SCOPe 2.07