SCOP 1.55: Domain d1a30b_: 1a30 B:

Lineage for d1a30b_ (1a30 B:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)

8. Domain d1a30b_: 1a30 B: [26554]

Details for d1a30b_

PDB Entry: 1a30, 2 Å

PDB Description: hiv-1 protease complexed with a tripeptide inhibitor

SCOP Domain Sequences for d1a30b_:

Sequence; same for both SEQRES and ATOM records:

>d1a30b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d1a30b_:

• d1a30b_ appears in SCOP 1.57
  
• d1a30b_ appears in the current release, SCOPe 2.08