Lineage for d3umge_ (3umg E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883848Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1883849Protein automated matches [190447] (49 species)
    not a true protein
  7. 1884201Species Rhodococcus jostii [TaxId:101510] [267896] (1 PDB entry)
  8. 1884206Domain d3umge_: 3umg E: [265532]
    automated match to d3umca_
    complexed with cl

Details for d3umge_

PDB Entry: 3umg (more details), 2.25 Å

PDB Description: Crystal Structure of the Defluorinating L-2-Haloacid Dehalogenase Rha0230
PDB Compounds: (E:) Haloacid dehalogenase

SCOPe Domain Sequences for d3umge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3umge_ c.108.1.0 (E:) automated matches {Rhodococcus jostii [TaxId: 101510]}
vpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwraryqp
smdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpdsvp
gltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaqvlg
lhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatditdla
aqlragst

SCOPe Domain Coordinates for d3umge_:

Click to download the PDB-style file with coordinates for d3umge_.
(The format of our PDB-style files is described here.)

Timeline for d3umge_: