Lineage for d3umgc_ (3umg C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490779Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2490780Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2491513Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2491514Protein automated matches [190447] (52 species)
    not a true protein
  7. 2491872Species Rhodococcus jostii [TaxId:101510] [267896] (1 PDB entry)
  8. 2491875Domain d3umgc_: 3umg C: [265530]
    automated match to d3umca_
    complexed with cl

Details for d3umgc_

PDB Entry: 3umg (more details), 2.25 Å

PDB Description: Crystal Structure of the Defluorinating L-2-Haloacid Dehalogenase Rha0230
PDB Compounds: (C:) Haloacid dehalogenase

SCOPe Domain Sequences for d3umgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3umgc_ c.108.1.0 (C:) automated matches {Rhodococcus jostii [TaxId: 101510]}
vpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwraryqp
smdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpdsvp
gltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaqvlg
lhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatditdla
aqlra

SCOPe Domain Coordinates for d3umgc_:

Click to download the PDB-style file with coordinates for d3umgc_.
(The format of our PDB-style files is described here.)

Timeline for d3umgc_: