Lineage for d1a30a_ (1a30 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2067628Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2067644Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2067878Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (476 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 2068421Domain d1a30a_: 1a30 A: [26553]

Details for d1a30a_

PDB Entry: 1a30 (more details), 2 Å

PDB Description: hiv-1 protease complexed with a tripeptide inhibitor
PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d1a30a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a30a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d1a30a_:

Click to download the PDB-style file with coordinates for d1a30a_.
(The format of our PDB-style files is described here.)

Timeline for d1a30a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a30b_