Lineage for d3ulqb_ (3ulq B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984691Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1984777Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 1984778Protein automated matches [190858] (17 species)
    not a true protein
  7. 1984781Species Bacillus subtilis [TaxId:1423] [225130] (3 PDB entries)
  8. 1984782Domain d3ulqb_: 3ulq B: [265526]
    automated match to d2rnja_
    protein/DNA complex; complexed with mn

Details for d3ulqb_

PDB Entry: 3ulq (more details), 2.3 Å

PDB Description: Crystal Structure of the Anti-Activator RapF Complexed with the Response Regulator ComA DNA Binding Domain
PDB Compounds: (B:) Transcriptional regulatory protein comA

SCOPe Domain Sequences for d3ulqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ulqb_ a.4.6.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
vltpreclilqevekgftnqeiadalhlskrsieysltsifnklnvgsrteavliaks

SCOPe Domain Coordinates for d3ulqb_:

Click to download the PDB-style file with coordinates for d3ulqb_.
(The format of our PDB-style files is described here.)

Timeline for d3ulqb_: