Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
Protein automated matches [190858] (17 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [225130] (3 PDB entries) |
Domain d3ulqb_: 3ulq B: [265526] automated match to d2rnja_ protein/DNA complex; complexed with mn |
PDB Entry: 3ulq (more details), 2.3 Å
SCOPe Domain Sequences for d3ulqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ulqb_ a.4.6.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} vltpreclilqevekgftnqeiadalhlskrsieysltsifnklnvgsrteavliaks
Timeline for d3ulqb_: