Lineage for d3uk7a1 (3uk7 A:3-190)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840330Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1840750Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 1840751Protein automated matches [190197] (18 species)
    not a true protein
  7. 1840918Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267895] (1 PDB entry)
  8. 1840919Domain d3uk7a1: 3uk7 A:3-190 [265520]
    automated match to d1oi4a1

Details for d3uk7a1

PDB Entry: 3uk7 (more details), 2.05 Å

PDB Description: Crystal Structure of Arabidopsis thaliana DJ-1D
PDB Compounds: (A:) Class I glutamine amidotransferase-like domain-containing protein

SCOPe Domain Sequences for d3uk7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uk7a1 c.23.16.0 (A:3-190) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nsrtvlilcgdymedyevmvpfqalqafgitvhtvcpgkkagdscptavhdfcghqtyfe
srghnftlnatfdevdlskydglvipggrapeylaltasvvelvkefsrsgkpiasichg
qlilaaadtvngrkctayatvgpslvaagakwvepitpdvcvvdgslitaatyeghpefi
qlfvkalg

SCOPe Domain Coordinates for d3uk7a1:

Click to download the PDB-style file with coordinates for d3uk7a1.
(The format of our PDB-style files is described here.)

Timeline for d3uk7a1: