Lineage for d3uh0a2 (3uh0 A:341-462)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856157Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1856158Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 1856277Family c.51.1.0: automated matches [227929] (1 protein)
    not a true family
  6. 1856278Protein automated matches [227930] (3 species)
    not a true protein
  7. 1856279Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267893] (3 PDB entries)
  8. 1856280Domain d3uh0a2: 3uh0 A:341-462 [265517]
    Other proteins in same PDB: d3uh0a1
    automated match to d4hwta2
    protein/RNA complex; complexed with so4, tsb, zn

Details for d3uh0a2

PDB Entry: 3uh0 (more details), 2 Å

PDB Description: Crystal structure of the yeast mitochondrial threonyl-tRNA synthetase (MST1) in complex with threonyl sulfamoyl adenylate
PDB Compounds: (A:) Threonyl-tRNA synthetase, mitochondrial

SCOPe Domain Sequences for d3uh0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uh0a2 c.51.1.0 (A:341-462) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
wpfwlnpyqaviipvntknvqqldmctalqkklrneleaddmepvplndwhfnvdldirn
epvgyriksailknysyliivgdeevqlqkynirerdnrksfekltmsqiwekfielekn
yk

SCOPe Domain Coordinates for d3uh0a2:

Click to download the PDB-style file with coordinates for d3uh0a2.
(The format of our PDB-style files is described here.)

Timeline for d3uh0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uh0a1