SCOPe 2.08: Domain d3ugqa2: 3ugq A:341-462

Lineage for d3ugqa2 (3ugq A:341-462)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.0: automated matches [227929] (1 protein)
   not a true family

6. Protein automated matches [227930] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267893] (3 PDB entries)

8. Domain d3ugqa2: 3ugq A:341-462 [265515]
   Other proteins in same PDB: d3ugqa1
   automated match to d4hwta2
   complexed with k, so4, zn

Details for d3ugqa2

PDB Entry: 3ugq, 2.1 Å

PDB Description: Crystal structure of the apo form of the yeast mitochondrial threonyl-tRNA synthetase determined at 2.1 Angstrom resolution

PDB Compounds: (A:) Threonyl-tRNA synthetase, mitochondrial

SCOPe Domain Sequences for d3ugqa2:

Sequence; same for both SEQRES and ATOM records:

>d3ugqa2 c.51.1.0 (A:341-462) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
wpfwlnpyqaviipvntknvqqldmctalqkklrneleaddmepvplndwhfnvdldirn
epvgyriksailknysyliivgdeevqlqkynirerdnrksfekltmsqiwekfielekn
yk

Timeline for d3ugqa2:

• d3ugqa2 first appeared in SCOPe 2.05
  
• d3ugqa2 appears in SCOPe 2.07