Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
Protein automated matches [226887] (9 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267892] (3 PDB entries) |
Domain d3ugqa1: 3ugq A:33-340 [265514] Other proteins in same PDB: d3ugqa2 automated match to d4hwta1 complexed with k, so4, zn |
PDB Entry: 3ugq (more details), 2.1 Å
SCOPe Domain Sequences for d3ugqa1:
Sequence, based on SEQRES records: (download)
>d3ugqa1 d.104.1.0 (A:33-340) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} atpatmtsmvsqrqdlfmtdplspgsmfflpngakifnkliefmklqqkfkfgfnevvtp liykktlweksghwenyaddmfkvettdeekeeyglkpmncpghclifgkkdrsynelpl rfsdfsplhrneasgalsgltrlrkfhqddghifctpsqvkseifnslklidivynkifp fvkggsgaesnyfinfstrpdhfigdlkvwnhaeqvlkeileesgkpwklnpgdgafygp kldimvtdhlrkthqvatiqldfqlperfdlkfkdqdnsykrpimihratfgsierfmal lidsnegr
>d3ugqa1 d.104.1.0 (A:33-340) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} atpatmtsmvsqrqdlfmtdplspgsmfflpngakifnkliefmklqqkfkfgfnevvtp liykktlweksghwenyaddmfkvettdeekeeyglkpmncpghclifgkkdrsynelpl rfsdfsplhrneasgalsgltrlrkfhqddghifctpsqvkseifnslklidivynkifp fvgaesnyfinfstrpdhfigdlkvwnhaeqvlkeileesgkpwklnpgdgafygpkldi mvtdhlrkthqvatiqldfqlperfdlkfkdqdnsykrpimihratfgsierfmallids negr
Timeline for d3ugqa1: