Lineage for d3ugma_ (3ugm A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016947Fold a.298: Left-handed alpha-alpha superhelix [267589] (1 superfamily)
    multihelical; 2 (curved) layers: alpha/alpha; left-handed superhelix
  4. 2016948Superfamily a.298.1: TAL effector-like [267596] (1 family) (S)
    Pfam PF03377; repeat; repeats form left-handed bundles that associate in a right-handed superstructure. PubMed 22223736
  5. 2016949Family a.298.1.1: TAL (transcription activator-like) effector [267609] (5 protein domains)
  6. 2016962Protein PthXo1 [267644] (1 species)
  7. 2016963Species Xanthomonas oryzae [TaxId:360094] [267703] (1 PDB entry)
  8. 2016964Domain d3ugma_: 3ugm A: [265513]
    protein/DNA complex

Details for d3ugma_

PDB Entry: 3ugm (more details), 3 Å

PDB Description: Structure of TAL effector PthXo1 bound to its DNA target
PDB Compounds: (A:) TAL effector AvrBs3/PthA

SCOPe Domain Sequences for d3ugma_:

Sequence, based on SEQRES records: (download)

>d3ugma_ a.298.1.1 (A:) PthXo1 {Xanthomonas oryzae [TaxId: 360094]}
kpkvrstvaqhhealvghgfthahivalsqhpaalgtvavtyqhiitalpeathedivgv
gkqwsgaralealltdagelrgpplqldtgqlvkiakrggvtameavhasrnaltgapln
ltpaqvvaiasnnggkqaletvqrllpvlcqahgltpaqvvaiashdggkqaletmqrll
pvlcqahglppdqvvaiasniggkqaletvqrllpvlcqahgltpdqvvaiashgggkqa
letvqrllpvlcqahgltpdqvvaiashdggkqaletvqrllpvlcqahgltpdqvvaia
sngggkqaletvqrllpvlcqahgltpdqvvaiasnggkqaletvqrllpvlcqahgltp
dqvvaiashdggkqaletvqrllpvlcqthgltpaqvvaiashdggkqaletvqqllpvl
cqahgltpdqvvaiasniggkqalatvqrllpvlcqahgltpdqvvaiasngggkqalet
vqrllpvlcqahgltpdqvvaiasngggkqaletvqrllpvlcqahgltqvqvvaiasni
ggkqaletvqrllpvlcqahgltpaqvvaiashdggkqaletvqrllpvlcqahgltpdq
vvaiasngggkqaletvqrllpvlcqahgltqeqvvaiasnnggkqaletvqrllpvlcq
ahgltpdqvvaiasngggkqaletvqrllpvlcqahgltpaqvvaiasniggkqaletvq
rllpvlcqdhgltlaqvvaiasniggkqaletvqrllpvlcqahgltqdqvvaiasnigg
kqaletvqrllpvlcqdhgltpdqvvaiasniggkqaletvqrllpvlcqdhgltldqvv
aiasnggkqaletvqrllpvlcqdhgltpdqvvaiasnsg

Sequence, based on observed residues (ATOM records): (download)

>d3ugma_ a.298.1.1 (A:) PthXo1 {Xanthomonas oryzae [TaxId: 360094]}
kpkvrelvahivalsqhpaalgtvavtyqhiitalathedivgvgkqwsgaralealltd
agelrgpplqldtgqlvkiakrggvtameavhasrnaltplnltpaqvvaiasnnggkqa
letvqrllpvlcqahgltpaqvvaiashdggkqaletmqrllpvlcqahglppdqvvaia
sniggkqaletvqrllpvlcqahgltpdqvvaiashgggkqaletvqrllpvlcqahglt
pdqvvaiashdggkqaletvqrllpvlcqahgltpdqvvaiasngggkqaletvqrllpv
lcqahgltpdqvvaiasnggkqaletvqrllpvlcqahgltpdqvvaiashdggkqalet
vqrllpvlcqthgltpaqvvaiashdggkqaletvqqllpvlcqahgltpdqvvaiasni
ggkqalatvqrllpvlcqahgltpdqvvaiasngggkqaletvqrllpvlcqahgltpdq
vvaiasngggkqaletvqrllpvlcqahgltqvqvvaiasniggkqaletvqrllpvlcq
ahgltpaqvvaiashdggkqaletvqrllpvlcqahgltpdqvvaiasngggkqaletvq
rllpgltqeqvvaiasnnggkqaletvqrllpvlcqahgltpdqvvaiasngggkqalet
vqrllpvlcqahgltpaqvvaiasniggkqaletvqrllpvlcqdhgltlaqvvaiasni
ggkqaletvqrllpvlcqgltqdqvvaiasniggkqaletvqrllpvlcqdhgltpdqvv
aiasniggkqaletvqrllpvlcqdhgltldqvvaiasnggkqaletvqrllpvlcqdhg
ltpdqvvaiasnsg

SCOPe Domain Coordinates for d3ugma_:

Click to download the PDB-style file with coordinates for d3ugma_.
(The format of our PDB-style files is described here.)

Timeline for d3ugma_: