Lineage for d3ubmd_ (3ubm D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2493182Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2493183Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2493276Family c.123.1.0: automated matches [267628] (1 protein)
    not a true family
  6. 2493277Protein automated matches [267679] (3 species)
    not a true protein
  7. 2493278Species Acetobacter aceti [TaxId:435] [267891] (1 PDB entry)
  8. 2493282Domain d3ubmd_: 3ubm D: [265512]
    automated match to d2vjqa_
    complexed with coa

Details for d3ubmd_

PDB Entry: 3ubm (more details), 1.99 Å

PDB Description: Formyl-CoA:oxalate CoA-transferase from Acetobacter aceti
PDB Compounds: (D:) Formyl-CoA:oxalate CoA-transferase

SCOPe Domain Sequences for d3ubmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubmd_ c.123.1.0 (D:) automated matches {Acetobacter aceti [TaxId: 435]}
nskpldgikvidfggvqsvpsaaqllawygadvikiervgvgditrnqlrdipdadalyf
tmlncnkrsvelntktpegkavfekcikwadillenfrpgamermgftweylqqlnprli
ygtvkgfgenspwagvsayenvaqcaggatsttgywngaplvdgqapgnnngplvsaaal
gdsntgnhlligvlaalfgrertgkgqkisvsmqdavlnlcrvklrdqqrlervgyleey
pqypngkfgdtvprggnaggggqpgwilkckgwetddnayiyctvqeqdwgptceaigkp
ewatdpkyntakarethmfeifaaiekaiadktkyeavahlakyrvpcspvlsmkeiaea
pdlresgtivevqqpkrgtfltinpikfsgftpeikaapllgqhtdevlaelgysaeeik
slrdkkitca

SCOPe Domain Coordinates for d3ubmd_:

Click to download the PDB-style file with coordinates for d3ubmd_.
(The format of our PDB-style files is described here.)

Timeline for d3ubmd_: