![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily) consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit |
![]() | Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) ![]() |
![]() | Family c.123.1.0: automated matches [267628] (1 protein) not a true family |
![]() | Protein automated matches [267679] (4 species) not a true protein |
![]() | Species Acetobacter aceti [TaxId:435] [267891] (1 PDB entry) |
![]() | Domain d3ubmd_: 3ubm D: [265512] automated match to d2vjqa_ complexed with coa |
PDB Entry: 3ubm (more details), 1.99 Å
SCOPe Domain Sequences for d3ubmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ubmd_ c.123.1.0 (D:) automated matches {Acetobacter aceti [TaxId: 435]} nskpldgikvidfggvqsvpsaaqllawygadvikiervgvgditrnqlrdipdadalyf tmlncnkrsvelntktpegkavfekcikwadillenfrpgamermgftweylqqlnprli ygtvkgfgenspwagvsayenvaqcaggatsttgywngaplvdgqapgnnngplvsaaal gdsntgnhlligvlaalfgrertgkgqkisvsmqdavlnlcrvklrdqqrlervgyleey pqypngkfgdtvprggnaggggqpgwilkckgwetddnayiyctvqeqdwgptceaigkp ewatdpkyntakarethmfeifaaiekaiadktkyeavahlakyrvpcspvlsmkeiaea pdlresgtivevqqpkrgtfltinpikfsgftpeikaapllgqhtdevlaelgysaeeik slrdkkitca
Timeline for d3ubmd_: