Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily) consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit |
Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) |
Family c.123.1.0: automated matches [267628] (1 protein) not a true family |
Protein automated matches [267679] (2 species) not a true protein |
Species Acetobacter aceti [TaxId:435] [267891] (1 PDB entry) |
Domain d3ubmc_: 3ubm C: [265511] automated match to d2vjqa_ complexed with coa |
PDB Entry: 3ubm (more details), 1.99 Å
SCOPe Domain Sequences for d3ubmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ubmc_ c.123.1.0 (C:) automated matches {Acetobacter aceti [TaxId: 435]} skpldgikvidfggvqsvpsaaqllawygadvikiervgvgditrnqlrdipdadalyft mlncnkrsvelntktpegkavfekcikwadillenfrpgamermgftweylqqlnprliy gtvkgfgenspwagvsayenvaqcaggatsttgywngaplvdgqapgnnngplvsaaalg dsntgnhlligvlaalfgrertgkgqkisvsmqdavlnlcrvklrdqqrlervgyleeyp qypngkfgdtvprggnaggggqpgwilkckgwetddnayiyctvqeqdwgptceaigkpe watdpkyntakarethmfeifaaiekaiadktkyeavahlakyrvpcspvlsmkeiaeap dlresgtivevqqpkrgtfltinpikfsgftpeikaapllgqhtdevlaelgysaeeiks lrdkkitca
Timeline for d3ubmc_: