Lineage for d3ubma_ (3ubm A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150853Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2150854Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2150947Family c.123.1.0: automated matches [267628] (1 protein)
    not a true family
  6. 2150948Protein automated matches [267679] (3 species)
    not a true protein
  7. 2150949Species Acetobacter aceti [TaxId:435] [267891] (1 PDB entry)
  8. 2150950Domain d3ubma_: 3ubm A: [265509]
    automated match to d2vjqa_
    complexed with coa

Details for d3ubma_

PDB Entry: 3ubm (more details), 1.99 Å

PDB Description: Formyl-CoA:oxalate CoA-transferase from Acetobacter aceti
PDB Compounds: (A:) Formyl-CoA:oxalate CoA-transferase

SCOPe Domain Sequences for d3ubma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubma_ c.123.1.0 (A:) automated matches {Acetobacter aceti [TaxId: 435]}
kpldgikvidfggvqsvpsaaqllawygadvikiervgvgditrnqlrdipdadalyftm
lncnkrsvelntktpegkavfekcikwadillenfrpgamermgftweylqqlnprliyg
tvkgfgenspwagvsayenvaqcaggatsttgywngaplvdgqapgnnngplvsaaalgd
sntgnhlligvlaalfgrertgkgqkisvsmqdavlnlcrvklrdqqrlervgyleeypq
ypngkfgdtvprggnaggggqpgwilkckgwetddnayiyctvqeqdwgptceaigkpew
atdpkyntakarethmfeifaaiekaiadktkyeavahlakyrvpcspvlsmkeiaeapd
lresgtivevqqpkrgtfltinpikfsgftpeikaapllgqhtdevlaelgysaeeiksl
rdkkitca

SCOPe Domain Coordinates for d3ubma_:

Click to download the PDB-style file with coordinates for d3ubma_.
(The format of our PDB-style files is described here.)

Timeline for d3ubma_: