SCOPe 2.08: Domain d3u5ei_: 3u5e I:

Lineage for d3u5ei_ (3u5e I:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267998] (4 PDB entries)
   Because SCOP is not case sensitive, we included upper case chains from 3u5c and 3u5e and lower case chains from 3u5g and 3u5i

8. Domain d3u5ei_: 3u5e I: [265465]
   protein/RNA complex; complexed with zn

Details for d3u5ei_

PDB Entry: 3u5e, 3 Å

PDB Description: The structure of the eukaryotic ribosome at 3.0 A resolution. This entry contains proteins of the 60S subunit, ribosome A

PDB Compounds: (I:) 60S ribosomal protein L10

SCOPe Domain Sequences for d3u5ei_:

Sequence, based on SEQRES records:

>d3u5ei_ i.1.1.1 (I:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
arrparcyryqknkpypksrynravpdskiriydlgkkkatvdefplcvhlvsneleqls
sealeaaricankymttvsgrdafhlrvrvhpfhvlrinkmlscagadrlqqgmrgawgk
phglaarvdigqiifsvrtkdsnkdvvveglrrarykfpgqqkiilskkwgftnldrpey
lkkreagevkddgafvkflskkgslennirefpeyfaaqa

Sequence, based on observed residues (ATOM records):

>d3u5ei_ i.1.1.1 (I:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
arrparcyryqknkpypksrynravpdskiriydlgkkkatvdefplcvhlvsneleqls
sealeaaricankymttvsgrdafhlrvrvhpfhvlrinkmqqgmrgawgkphglaarvd
igqiifsvrtkdsnkdvvveglrrarykfpgqqkiilskkwgftnldrpeylkkreagev
kddgafvkflskkgslennirefpeyfaaqa

Timeline for d3u5ei_:

• d3u5ei_ first appeared in SCOPe 2.05
  
• d3u5ei_ appears in SCOPe 2.07