Lineage for d3u5eh_ (3u5e H:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3043338Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species)
  7. 3043384Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267998] (4 PDB entries)
    Because SCOP is not case sensitive, we included upper case chains from 3u5c and 3u5e and lower case chains from 3u5g and 3u5i
  8. 3043411Domain d3u5eh_: 3u5e H: [265464]
    protein/RNA complex; complexed with zn

Details for d3u5eh_

PDB Entry: 3u5e (more details), 3 Å

PDB Description: The structure of the eukaryotic ribosome at 3.0 A resolution. This entry contains proteins of the 60S subunit, ribosome A
PDB Compounds: (H:) 60S ribosomal protein L9-A

SCOPe Domain Sequences for d3u5eh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u5eh_ i.1.1.1 (H:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mkyiqteqqievpegvtvsiksrivkvvgprgtltknlkhidvtftkvnnqlikvavhng
grkhvaalrtvkslvdnmitgvtkgykykmryvyahfpinvnivekdgakfievrnflgd
kkirnvpvrdgvtiefstnvkdeivlsgnsvedvsqnaadlqqicrvrnkdirkfldgiy
vshkgfitedl

SCOPe Domain Coordinates for d3u5eh_:

Click to download the PDB-style file with coordinates for d3u5eh_.
(The format of our PDB-style files is described here.)

Timeline for d3u5eh_: