Lineage for d1dw6c_ (1dw6 C:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins) Protein Human immunodeficiency virus type 1 protease [50632] (1 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries) 
Domain d1dw6c_: 1dw6 C: [26545]
Details for d1dw6c_
PDB Entry: 1dw6 (more details), 1.88 Å
PDB Description: structural and kinetic analysis of drug resistant mutants of hiv-1 protease
SCOP Domain Sequences for d1dw6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dw6c_ b.50.1.1 (C:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlmtqigatlnf
SCOP Domain Coordinates for d1dw6c_:
Click to download the PDB-style file with coordinates for d1dw6c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dw6c_:
- d1dw6c_ appears in SCOP 1.57
- d1dw6c_ appears in the current release, SCOPe 2.08
View in 3D
