| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
| Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267998] (4 PDB entries) Because SCOP is not case sensitive, we included upper case chains from 3u5c and 3u5e and lower case chains from 3u5g and 3u5i |
| Domain d3u5ce_: 3u5c E: [265435] protein/RNA complex; complexed with zn |
PDB Entry: 3u5c (more details), 3 Å
SCOPe Domain Sequences for d3u5ce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u5ce_ i.1.1.1 (E:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
argpkkhlkrlaaphhwlldklsgcyaprpsagphklreslplivflrnrlkyalngrev
kailmqrhvkvdgkvrtdttypagfmdvitldatnenfrlvydvkgrfavhritdeeasy
klgkvkkvqlgkkgvpyvvthdgrtirypdpnikvndtvkidlasgkitdfikfdagklv
yvtggrnlgrigtivhkerhdggfdlvhikdsldntfvtrlnnvfvigeqgkpyislpkg
kgiklsiaeerdrrraqqgl
Timeline for d3u5ce_: