SCOPe 2.05: Domain d3twbd2: 3twb D:119-419

Lineage for d3twbd2 (3twb D:119-419)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein automated matches [226997] (11 species)
   not a true protein

7. Species Salmonella enterica [TaxId:550537] [267890] (3 PDB entries)

8. Domain d3twbd2: 3twb D:119-419 [265426]
   Other proteins in same PDB: d3twba1, d3twbb1, d3twbc1, d3twbd1, d3twbe1
   automated match to d4ihca2
   complexed with cl, gco, gol, mg

Details for d3twbd2

PDB Entry: 3twb, 1.76 Å

PDB Description: crystal structure of gluconate dehydratase (target efi-501679) from salmonella enterica subsp. enterica serovar enteritidis str. p125109 complexed with magnesium and gluconic acid

PDB Compounds: (D:) Putative dehydratase

SCOPe Domain Sequences for d3twbd2:

Sequence; same for both SEQRES and ATOM records:

>d3twbd2 c.1.11.2 (D:119-419) automated matches {Salmonella enterica [TaxId: 550537]}
kcrdgiplychtdggdevevednirarmeegyqyvrcqmgmyggagtddlkliatqlara
kniqpkrsprsktpgiyfdpdayaksvprlfdhlrnklgfgiefihdvhervtpvtainl
aktleqyqlfyledpvapenidwlkmlrqqsstpismgelfvnvnewkplidnrlidyir
chvstiggitparklavyselngvrtawhgpgdispvgvcanmhldlsspnfgiqeytpm
ndalrdvfpgcpeidhgyaylndkpglgidideakaakypceggipswtmartpdgtasr
p

Timeline for d3twbd2:

• d3twbd2 is new in SCOPe 2.05-stable
  
• d3twbd2 appears in SCOPe 2.06
  
• d3twbd2 appears in the current release, SCOPe 2.08