Lineage for d3twbc1 (3twb C:3-118)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2192145Species Salmonella enterica [TaxId:550537] [267889] (3 PDB entries)
  8. 2192148Domain d3twbc1: 3twb C:3-118 [265423]
    Other proteins in same PDB: d3twba2, d3twbb2, d3twbc2, d3twbd2, d3twbe2
    automated match to d4ihca1
    complexed with cl, gco, gol, mg

Details for d3twbc1

PDB Entry: 3twb (more details), 1.76 Å

PDB Description: crystal structure of gluconate dehydratase (target efi-501679) from salmonella enterica subsp. enterica serovar enteritidis str. p125109 complexed with magnesium and gluconic acid
PDB Compounds: (C:) Putative dehydratase

SCOPe Domain Sequences for d3twbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3twbc1 d.54.1.0 (C:3-118) automated matches {Salmonella enterica [TaxId: 550537]}
vsnlkitnvktiltapggidlavvkietnepglyglgcatftqrifavksaideymapfl
vgkdptriediwqsgvvsgywrngpimnnalsgvdmalwdikgklagmpvydllgg

SCOPe Domain Coordinates for d3twbc1:

Click to download the PDB-style file with coordinates for d3twbc1.
(The format of our PDB-style files is described here.)

Timeline for d3twbc1: