![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:550537] [267889] (3 PDB entries) |
![]() | Domain d3twbc1: 3twb C:3-118 [265423] Other proteins in same PDB: d3twba2, d3twbb2, d3twbc2, d3twbd2, d3twbe2 automated match to d4ihca1 complexed with cl, gco, gol, mg |
PDB Entry: 3twb (more details), 1.76 Å
SCOPe Domain Sequences for d3twbc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3twbc1 d.54.1.0 (C:3-118) automated matches {Salmonella enterica [TaxId: 550537]} vsnlkitnvktiltapggidlavvkietnepglyglgcatftqrifavksaideymapfl vgkdptriediwqsgvvsgywrngpimnnalsgvdmalwdikgklagmpvydllgg
Timeline for d3twbc1: