SCOPe 2.05: Domain d3twae1: 3twa E:5-118

Lineage for d3twae1 (3twa E:5-118)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Salmonella enterica [TaxId:550537] [267889] (3 PDB entries)

8. Domain d3twae1: 3twa E:5-118 [265417]
   Other proteins in same PDB: d3twaa2, d3twab2, d3twac2, d3twad2, d3twae2
   automated match to d4ihca1
   complexed with cl, gol, mg

Details for d3twae1

PDB Entry: 3twa, 1.8 Å

PDB Description: crystal structure of gluconate dehydratase (target efi-501679) from salmonella enterica subsp. enterica serovar enteritidis str. p125109 complexed with magnesium and glycerol

PDB Compounds: (E:) Putative dehydratase

SCOPe Domain Sequences for d3twae1:

Sequence; same for both SEQRES and ATOM records:

>d3twae1 d.54.1.0 (E:5-118) automated matches {Salmonella enterica [TaxId: 550537]}
nlkitnvktiltapggidlavvkietnepglyglgcatftqrifavksaideymapflvg
kdptriediwqsgvvsgywrngpimnnalsgvdmalwdikgklagmpvydllgg

Timeline for d3twae1:

• d3twae1 is new in SCOPe 2.05-stable
  
• d3twae1 appears in SCOPe 2.06
  
• d3twae1 appears in the current release, SCOPe 2.08