![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
![]() | Protein automated matches [226997] (13 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:550537] [267890] (3 PDB entries) |
![]() | Domain d3twab2: 3twa B:119-419 [265412] Other proteins in same PDB: d3twaa1, d3twab1, d3twac1, d3twad1, d3twae1 automated match to d4ihca2 complexed with cl, gol, mg |
PDB Entry: 3twa (more details), 1.8 Å
SCOPe Domain Sequences for d3twab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3twab2 c.1.11.2 (B:119-419) automated matches {Salmonella enterica [TaxId: 550537]} kcrdgiplychtdggdevevednirarmeegyqyvrcqmgmyggagtddlkliatqlara kniqpkrsprsktpgiyfdpdayaksvprlfdhlrnklgfgiefihdvhervtpvtainl aktleqyqlfyledpvapenidwlkmlrqqsstpismgelfvnvnewkplidnrlidyir chvstiggitparklavyselngvrtawhgpgdispvgvcanmhldlsspnfgiqeytpm ndalrdvfpgcpeidhgyaylndkpglgidideakaakypceggipswtmartpdgtasr p
Timeline for d3twab2: