Lineage for d3tuea_ (3tue A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132842Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2133248Protein automated matches [190100] (19 species)
    not a true protein
  7. 2133532Species Leishmania major [TaxId:5664] [226407] (3 PDB entries)
  8. 2133534Domain d3tuea_: 3tue A: [265400]
    automated match to d3qpme_

Details for d3tuea_

PDB Entry: 3tue (more details), 3 Å

PDB Description: The structure of tryparedoxin peroxidase I from Leishmania major
PDB Compounds: (A:) tryparedoxin peroxidase

SCOPe Domain Sequences for d3tuea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tuea_ c.47.1.10 (A:) automated matches {Leishmania major [TaxId: 5664]}
gnakinspapsfeevalmpngsfkkislssykgkwvvlffypldftfvcpteviafsdsv
srfnelncevlacsidseyahlqwtlqdrkkgglgtmaipiladktkniarsygvleesq
gvayrglfiidphgmlrqitvndmpvgrsveevlrlleafqfvekh

SCOPe Domain Coordinates for d3tuea_:

Click to download the PDB-style file with coordinates for d3tuea_.
(The format of our PDB-style files is described here.)

Timeline for d3tuea_: