Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.0: automated matches [191548] (1 protein) not a true family |
Protein automated matches [190944] (28 species) not a true protein |
Species Escherichia coli [TaxId:83333] [256409] (3 PDB entries) |
Domain d3tlkc_: 3tlk C: [265399] automated match to d2m6ka_ complexed with dio, eb4, fe |
PDB Entry: 3tlk (more details), 1.85 Å
SCOPe Domain Sequences for d3tlkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tlkc_ c.92.2.0 (C:) automated matches {Escherichia coli [TaxId: 83333]} dwprqitdsrgthtlesqpqrivstsvtltgsllaidapviasgattpnnrvaddqgflr qwskvakerklqrlyigepsaeavaaqmpdlilisatggdsalalydqlstiaptliiny ddkswqslltqlgeitghekqaaeriaqfdkqlaaakeqiklppqpvtaivytaaahsan lwtpesaqgqmleqlgftlaklpaglnasqsqgkrhdiiqlggenlaaglngeslflfag dqkdadaiyanpllahlpavqnkqvyalgtetfrldyysamqvldrlkalflehh
Timeline for d3tlkc_: