| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (79 species) not a true protein |
| Species Enterobacter sp. [TaxId:399742] [267888] (1 PDB entry) |
| Domain d3tjia2: 3tji A:116-399 [265387] Other proteins in same PDB: d3tjia1, d3tjib1, d3tjic1, d3tjid1 automated match to d3gy1a2 complexed with cl, gol, mg |
PDB Entry: 3tji (more details), 1.8 Å
SCOPe Domain Sequences for d3tjia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tjia2 c.1.11.0 (A:116-399) automated matches {Enterobacter sp. [TaxId: 399742]}
ksrdaipayshasgetlealfasvdaliaqgyrhircqlgfyggtpsalhapdnptpgaw
fdqqeymsntvemfhalrekygwklhilhdvherlfpqqavqlakqlepfqpyfiedilp
pqqsawleqvrqqscvplalgelfnnpaewhdlivnrridfirchvsqiggitpalklah
lcqafgvrlawhgpgdmtpigvavnthlnihlhnaaiqefiprsattndvfpgapevkeg
fvyppvqpgigvgfnealalahpvlyrphewtqsrlpdgtihtp
Timeline for d3tjia2: