Lineage for d3tjia1 (3tji A:1-115)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948189Species Enterobacter sp. [TaxId:399742] [267887] (1 PDB entry)
  8. 2948190Domain d3tjia1: 3tji A:1-115 [265386]
    Other proteins in same PDB: d3tjia2, d3tjib2, d3tjic2, d3tjid2
    automated match to d3gy1a1
    complexed with cl, gol, mg

Details for d3tjia1

PDB Entry: 3tji (more details), 1.8 Å

PDB Description: crystal structure of an enolase from enterobacter sp. 638 (efi target efi-501662) with bound mg
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein

SCOPe Domain Sequences for d3tjia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tjia1 d.54.1.0 (A:1-115) automated matches {Enterobacter sp. [TaxId: 399742]}
mtpviikniecfitrpdrhnlvtvrvtteqgitghgcatfqqrplavktlvdeylqplmi
grdanniedlwqmmnvnaywrngplmnnaisgvdmalwdikgqlagmplyqlfgg

SCOPe Domain Coordinates for d3tjia1:

Click to download the PDB-style file with coordinates for d3tjia1.
(The format of our PDB-style files is described here.)

Timeline for d3tjia1: