SCOPe 2.08: Domain d3tjia1: 3tji A:1-115

Lineage for d3tjia1 (3tji A:1-115)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Enterobacter sp. [TaxId:399742] [267887] (1 PDB entry)

8. Domain d3tjia1: 3tji A:1-115 [265386]
   Other proteins in same PDB: d3tjia2, d3tjib2, d3tjic2, d3tjid2
   automated match to d3gy1a1
   complexed with cl, gol, mg

Details for d3tjia1

PDB Entry: 3tji, 1.8 Å

PDB Description: crystal structure of an enolase from enterobacter sp. 638 (efi target efi-501662) with bound mg

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein

SCOPe Domain Sequences for d3tjia1:

Sequence; same for both SEQRES and ATOM records:

>d3tjia1 d.54.1.0 (A:1-115) automated matches {Enterobacter sp. [TaxId: 399742]}
mtpviikniecfitrpdrhnlvtvrvtteqgitghgcatfqqrplavktlvdeylqplmi
grdanniedlwqmmnvnaywrngplmnnaisgvdmalwdikgqlagmplyqlfgg

Timeline for d3tjia1:

• d3tjia1 first appeared in SCOPe 2.05
  
• d3tjia1 appears in SCOPe 2.07