Lineage for d3thub1 (3thu B:1-112)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948576Species Sphingomonas sp. [TaxId:314266] [267885] (1 PDB entry)
  8. 2948578Domain d3thub1: 3thu B:1-112 [265382]
    Other proteins in same PDB: d3thua2, d3thua3, d3thub2, d3thub3, d3thuc2, d3thuc3
    automated match to d4il2a1
    complexed with cl, gol, mg, unx

Details for d3thub1

PDB Entry: 3thu (more details), 1.8 Å

PDB Description: crystal structure of an enolase from sphingomonas sp. ska58 (efi target efi-501683) with bound mg
PDB Compounds: (B:) Mandelate racemase / muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d3thub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3thub1 d.54.1.0 (B:1-112) automated matches {Sphingomonas sp. [TaxId: 314266]}
mpkiidakviitcpgrnfvtlkimtdegvyglgdatlngrelavasyltdhvipcligrd
ahriedlwqylykgaywrrgpvtmtaiaavdmalwdikgkiaglpvyqllgg

SCOPe Domain Coordinates for d3thub1:

Click to download the PDB-style file with coordinates for d3thub1.
(The format of our PDB-style files is described here.)

Timeline for d3thub1: