SCOPe 2.05: Domain d3thua1: 3thu A:-1-112

Lineage for d3thua1 (3thu A:-1-112)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Sphingomonas sp. [TaxId:314266] [267885] (1 PDB entry)

8. Domain d3thua1: 3thu A:-1-112 [265380]
   Other proteins in same PDB: d3thua2, d3thub2, d3thuc2
   automated match to d4il2a1
   complexed with cl, gol, mg, unx

Details for d3thua1

PDB Entry: 3thu, 1.8 Å

PDB Description: crystal structure of an enolase from sphingomonas sp. ska58 (efi target efi-501683) with bound mg

PDB Compounds: (A:) Mandelate racemase / muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d3thua1:

Sequence; same for both SEQRES and ATOM records:

>d3thua1 d.54.1.0 (A:-1-112) automated matches {Sphingomonas sp. [TaxId: 314266]}
smmpkiidakviitcpgrnfvtlkimtdegvyglgdatlngrelavasyltdhvipclig
rdahriedlwqylykgaywrrgpvtmtaiaavdmalwdikgkiaglpvyqllgg

Timeline for d3thua1:

• d3thua1 is new in SCOPe 2.05-stable
  
• d3thua1 appears in SCOPe 2.06
  
• d3thua1 appears in the current release, SCOPe 2.08