Lineage for d3t6cb1 (3t6c B:4-116)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2192030Species Pantoea ananatis [TaxId:706191] [267883] (1 PDB entry)
  8. 2192032Domain d3t6cb1: 3t6c B:4-116 [265378]
    Other proteins in same PDB: d3t6ca2, d3t6cb2
    automated match to d4ihca1
    complexed with cl, edo, gco, mg, unx

Details for d3t6cb1

PDB Entry: 3t6c (more details), 1.6 Å

PDB Description: crystal structure of an enolase from pantoea ananatis (efi target efi- 501676) with bound d-gluconate and mg
PDB Compounds: (B:) Putative ManD family dehydratase

SCOPe Domain Sequences for d3t6cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t6cb1 d.54.1.0 (B:4-116) automated matches {Pantoea ananatis [TaxId: 706191]}
lfitnvktiltapggidlvvvkietnepglyglgcatftqriyavqsaideylapfligk
dpariediwqsaavsgywrngpvmnnalsgidmalwdikgkqaglpvyellgg

SCOPe Domain Coordinates for d3t6cb1:

Click to download the PDB-style file with coordinates for d3t6cb1.
(The format of our PDB-style files is described here.)

Timeline for d3t6cb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3t6cb2