Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Pantoea ananatis [TaxId:706191] [267883] (1 PDB entry) |
Domain d3t6cb1: 3t6c B:4-116 [265378] Other proteins in same PDB: d3t6ca2, d3t6cb2 automated match to d4ihca1 complexed with cl, edo, gco, mg, unx |
PDB Entry: 3t6c (more details), 1.6 Å
SCOPe Domain Sequences for d3t6cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t6cb1 d.54.1.0 (B:4-116) automated matches {Pantoea ananatis [TaxId: 706191]} lfitnvktiltapggidlvvvkietnepglyglgcatftqriyavqsaideylapfligk dpariediwqsaavsgywrngpvmnnalsgidmalwdikgkqaglpvyellgg
Timeline for d3t6cb1: