Lineage for d3t6ca2 (3t6c A:117-417)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836928Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2837122Protein automated matches [226997] (13 species)
    not a true protein
  7. 2837192Species Pantoea ananatis [TaxId:706191] [267884] (1 PDB entry)
  8. 2837193Domain d3t6ca2: 3t6c A:117-417 [265377]
    Other proteins in same PDB: d3t6ca1, d3t6cb1
    automated match to d4ihca2
    complexed with cl, edo, gco, mg, unx

Details for d3t6ca2

PDB Entry: 3t6c (more details), 1.6 Å

PDB Description: crystal structure of an enolase from pantoea ananatis (efi target efi- 501676) with bound d-gluconate and mg
PDB Compounds: (A:) Putative ManD family dehydratase

SCOPe Domain Sequences for d3t6ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t6ca2 c.1.11.2 (A:117-417) automated matches {Pantoea ananatis [TaxId: 706191]}
kcrdgialyvhtdgadevevedsarakmeegyqyircqmgmyggagtddlrlianrmvka
kniqpkrsprtkapgiyfdpeayaksiprlfdhlrnklgfsvellhdaheritpinaihm
akalepyqlffledpvapentewlkmlrqqsstpiamgelfvnvnewkplidnklidyir
chissiggitpakkiaiyselngvrtawhspgdispigvcanmhldlsspnfgiqeytpm
ndalrevfpgcpevdqgyayvndkpglgidinealaakfpceggnptwtmartpdgtvwr
p

SCOPe Domain Coordinates for d3t6ca2:

Click to download the PDB-style file with coordinates for d3t6ca2.
(The format of our PDB-style files is described here.)

Timeline for d3t6ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3t6ca1