SCOPe 2.08: Domain d3t6ca2: 3t6c A:117-417

Lineage for d3t6ca2 (3t6c A:117-417)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein automated matches [226997] (13 species)
   not a true protein

7. Species Pantoea ananatis [TaxId:706191] [267884] (1 PDB entry)

8. Domain d3t6ca2: 3t6c A:117-417 [265377]
   Other proteins in same PDB: d3t6ca1, d3t6cb1
   automated match to d4ihca2
   complexed with cl, edo, gco, mg, unx

Details for d3t6ca2

PDB Entry: 3t6c, 1.6 Å

PDB Description: crystal structure of an enolase from pantoea ananatis (efi target efi- 501676) with bound d-gluconate and mg

PDB Compounds: (A:) Putative ManD family dehydratase

SCOPe Domain Sequences for d3t6ca2:

Sequence; same for both SEQRES and ATOM records:

>d3t6ca2 c.1.11.2 (A:117-417) automated matches {Pantoea ananatis [TaxId: 706191]}
kcrdgialyvhtdgadevevedsarakmeegyqyircqmgmyggagtddlrlianrmvka
kniqpkrsprtkapgiyfdpeayaksiprlfdhlrnklgfsvellhdaheritpinaihm
akalepyqlffledpvapentewlkmlrqqsstpiamgelfvnvnewkplidnklidyir
chissiggitpakkiaiyselngvrtawhspgdispigvcanmhldlsspnfgiqeytpm
ndalrevfpgcpevdqgyayvndkpglgidinealaakfpceggnptwtmartpdgtvwr
p

Timeline for d3t6ca2:

• d3t6ca2 first appeared in SCOPe 2.05
  
• d3t6ca2 appears in SCOPe 2.07