Lineage for d3t57a_ (3t57 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814388Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267882] (1 PDB entry)
  8. 2814389Domain d3t57a_: 3t57 A: [265375]
    automated match to d4eqyc_

Details for d3t57a_

PDB Entry: 3t57 (more details), 2.1 Å

PDB Description: Activity and Crystal Structure of Arabidopsis UDP-N-acetylglucosamine acyltransferase
PDB Compounds: (A:) UDP-N-acetylglucosamine O-acyltransferase domain-containing protein

SCOPe Domain Sequences for d3t57a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t57a_ b.81.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lihpsavvhpnavigkgvsvgpyctigssvklgngcklypsshvfgntelgescvlmtga
vvgdelpgytfigcnniighhavvgvkcqdlkykhgdecflcignnneirefcsihrssk
psdktvigdnnlimgschiahdckigdrnifanntllaghvvvednthtagasvvhqfch
igsfafigggsvvsqdvpkymmvageraelrglnleglrrngftmsemkslraayrkifm
stetvslsfeerlteleqdqelysvpavsamlqsirdsftesrrgick

SCOPe Domain Coordinates for d3t57a_:

Click to download the PDB-style file with coordinates for d3t57a_.
(The format of our PDB-style files is described here.)

Timeline for d3t57a_: