Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (36 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267882] (1 PDB entry) |
Domain d3t57a_: 3t57 A: [265375] automated match to d4eqyc_ |
PDB Entry: 3t57 (more details), 2.1 Å
SCOPe Domain Sequences for d3t57a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t57a_ b.81.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lihpsavvhpnavigkgvsvgpyctigssvklgngcklypsshvfgntelgescvlmtga vvgdelpgytfigcnniighhavvgvkcqdlkykhgdecflcignnneirefcsihrssk psdktvigdnnlimgschiahdckigdrnifanntllaghvvvednthtagasvvhqfch igsfafigggsvvsqdvpkymmvageraelrglnleglrrngftmsemkslraayrkifm stetvslsfeerlteleqdqelysvpavsamlqsirdsftesrrgick
Timeline for d3t57a_: