SCOPe 2.05: Domain d3suda_: 3sud A:

Lineage for d3suda_ (3sud A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (4 species)
   not a true protein

7. Species Hepatitis C virus subtype 1a [TaxId:31646] [226463] (19 PDB entries)

8. Domain d3suda_: 3sud A: [265371]
   automated match to d3sv6a_
   complexed with so4, sue, zn

Details for d3suda_

PDB Entry: 3sud, 1.96 Å

PDB Description: crystal structure of ns3/4a protease in complex with mk-5172

PDB Compounds: (A:) NS3 protease, NS4A protein

SCOPe Domain Sequences for d3suda_:

Sequence; same for both SEQRES and ATOM records:

>d3suda_ b.47.1.3 (A:) automated matches {Hepatitis C virus subtype 1a [TaxId: 31646]}
kgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsi
ngvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvt
rhadvipvrrrgdsrgsllsprpisylkgsaggpllcpaghavgifraavstrgvakavd
fipveslettm

Timeline for d3suda_:

• d3suda_ is new in SCOPe 2.05-stable
  
• d3suda_ appears in SCOPe 2.06
  
• d3suda_ appears in the current release, SCOPe 2.08