Lineage for d3senb1 (3sen B:8-74)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2328565Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2328708Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 2328709Protein automated matches [190031] (3 species)
    not a true protein
  7. 2328718Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries)
  8. 2328762Domain d3senb1: 3sen B:8-74 [265364]
    automated match to d3seia1
    complexed with k

Details for d3senb1

PDB Entry: 3sen (more details), 3.1 Å

PDB Description: Structure of Caskin1 Tandem SAMs
PDB Compounds: (B:) Caskin-1

SCOPe Domain Sequences for d3senb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3senb1 a.60.1.0 (B:8-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksseavsqwltafqlqlyapnfisagydlptisrmtpedltaigvtkpghrkkiaaeisg
lsipdwl

SCOPe Domain Coordinates for d3senb1:

Click to download the PDB-style file with coordinates for d3senb1.
(The format of our PDB-style files is described here.)

Timeline for d3senb1: