SCOPe 2.08: Domain d3senb1: 3sen B:8-74

Lineage for d3senb1 (3sen B:8-74)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries)

8. Domain d3senb1: 3sen B:8-74 [265364]
   automated match to d3seia1
   complexed with k

Details for d3senb1

PDB Entry: 3sen, 3.1 Å

PDB Description: Structure of Caskin1 Tandem SAMs

PDB Compounds: (B:) Caskin-1

SCOPe Domain Sequences for d3senb1:

Sequence; same for both SEQRES and ATOM records:

>d3senb1 a.60.1.0 (B:8-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksseavsqwltafqlqlyapnfisagydlptisrmtpedltaigvtkpghrkkiaaeisg
lsipdwl

Timeline for d3senb1:

• d3senb1 first appeared in SCOPe 2.05
  
• d3senb1 appears in SCOPe 2.07