Lineage for d3se5d_ (3se5 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738537Fold a.265: Fic-like [140930] (1 superfamily)
    multihelical; one central helix is surrounded by seven helices
  4. 2738538Superfamily a.265.1: Fic-like [140931] (1 family) (S)
  5. 2738539Family a.265.1.1: Fic-like [140932] (3 proteins)
    Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix
  6. 2738547Protein automated matches [191277] (4 species)
    not a true protein
  7. 2738585Species Neisseria meningitidis [TaxId:491] [189879] (5 PDB entries)
  8. 2738590Domain d3se5d_: 3se5 D: [265361]
    automated match to d3sn9a_
    complexed with anp, mg, p6g; mutant

Details for d3se5d_

PDB Entry: 3se5 (more details), 1.7 Å

PDB Description: fic protein from neisseria meningitidis mutant delta8 in complex with amppnp
PDB Compounds: (D:) Cell filamentation protein Fic-related protein

SCOPe Domain Sequences for d3se5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3se5d_ a.265.1.1 (D:) automated matches {Neisseria meningitidis [TaxId: 491]}
sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
vnwqnvsktlylqamerspvndlelrfllkdnltd

SCOPe Domain Coordinates for d3se5d_:

Click to download the PDB-style file with coordinates for d3se5d_.
(The format of our PDB-style files is described here.)

Timeline for d3se5d_: