SCOPe 2.05: Domain d3se5b_: 3se5 B:

Lineage for d3se5b_ (3se5 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.265: Fic-like [140930] (1 superfamily)
   multihelical; one central helix is surrounded by seven helices

4. Superfamily a.265.1: Fic-like [140931] (1 family)

5. Family a.265.1.1: Fic-like [140932] (3 proteins)
   Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix

6. Protein automated matches [191277] (2 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:491] [189879] (3 PDB entries)

8. Domain d3se5b_: 3se5 B: [265359]
   automated match to d3sn9a_
   complexed with anp, mg, p6g; mutant

Details for d3se5b_

PDB Entry: 3se5, 1.7 Å

PDB Description: fic protein from neisseria meningitidis mutant delta8 in complex with amppnp

PDB Compounds: (B:) Cell filamentation protein Fic-related protein

SCOPe Domain Sequences for d3se5b_:

Sequence; same for both SEQRES and ATOM records:

>d3se5b_ a.265.1.1 (B:) automated matches {Neisseria meningitidis [TaxId: 491]}
sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
vnwqnvsktlylqamerspvndlelrfllkdnltd

Timeline for d3se5b_:

• d3se5b_ is new in SCOPe 2.05-stable
  
• d3se5b_ appears in SCOPe 2.06
  
• d3se5b_ appears in the current release, SCOPe 2.08