Lineage for d3sbfd1 (3sbf D:4-117)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948683Species Vibrionales bacterium [TaxId:391574] [267877] (3 PDB entries)
  8. 2948687Domain d3sbfd1: 3sbf D:4-117 [265356]
    Other proteins in same PDB: d3sbfa2, d3sbfb2, d3sbfc2, d3sbfd2, d3sbfd3
    automated match to d3gy1a1
    complexed with d8t, epe, mg; mutant

Details for d3sbfd1

PDB Entry: 3sbf (more details), 1.5 Å

PDB Description: crystal structure of the mutant p311a of enolase superfamily member from vibrionales bacterium complexed with mg and d-arabinonate
PDB Compounds: (D:) Mandelate racemase / muconate lactonizing enzyme

SCOPe Domain Sequences for d3sbfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbfd1 d.54.1.0 (D:4-117) automated matches {Vibrionales bacterium [TaxId: 391574]}
ketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpilig
knanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfgg

SCOPe Domain Coordinates for d3sbfd1:

Click to download the PDB-style file with coordinates for d3sbfd1.
(The format of our PDB-style files is described here.)

Timeline for d3sbfd1: