Lineage for d3sajd1 (3saj D:4-373)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143939Protein automated matches [190296] (11 species)
    not a true protein
  7. 2143969Species Norway rat (Rattus norvegicus) [TaxId:10116] [267861] (5 PDB entries)
  8. 2143978Domain d3sajd1: 3saj D:4-373 [265349]
    Other proteins in same PDB: d3saja2, d3saja3, d3sajb2, d3sajc2, d3sajd2
    automated match to d3h5va_
    complexed with nag

Details for d3sajd1

PDB Entry: 3saj (more details), 2.5 Å

PDB Description: Crystal Structure of glutamate receptor GluA1 Amino Terminal Domain
PDB Compounds: (D:) Glutamate receptor 1

SCOPe Domain Sequences for d3sajd1:

Sequence, based on SEQRES records: (download)

>d3sajd1 c.93.1.1 (D:4-373) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pnniqigglfpnqqsqehaafrfalsqlteppkllpqidivnisdsfemtyrfcsqfskg
vyaifgfyerrtvnmltsfcgalhvcfitpsfpvdtsnqfvlqlrpelqealisiidhyk
wqtfvyiydadrglsvlqrvldtaaeknwqvtavnilttteegyrmlfqdlekkkerlvv
vdceserlnailgqivklekngigyhyilanlgfmdidlnkfkesganvtgfqlvnytdt
iparimqqwrtsdsrdhtrvdwkrpkytsaltydgvkvmaeafqslrrqridisrrgnag
dclanpavpwgqgidiqralqqvrfegltgnvqfnekgrrtnytlhviemkhdgirkigy
wneddkfvpa

Sequence, based on observed residues (ATOM records): (download)

>d3sajd1 c.93.1.1 (D:4-373) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pnniqigglfpnqqsqehaafrfalsqlteppkllpqidivnisdsfemtyrfcsqfskg
vyaifgfyerrtvnmltsfcgalhvcfitpsfpvdtsnqfvlqlrpelqealisiidhyk
wqtfvyiydadrglsvlqrvldtaaeknwqvtavnilttteegyrmlfqdlekkkerlvv
vdceserlnailgqivklekngigyhyilanlgfmdidlnkfkesganvtgfqlvnytdt
iparimqqwrtsdsrdkrpkytsaltydgvkvmaeafqslrrqridisrrgnagdclanp
avpwgqgidiqralqqvrfegltgnvqfnekgrrtnytlhviemkhdgirkigywneddk
fvpa

SCOPe Domain Coordinates for d3sajd1:

Click to download the PDB-style file with coordinates for d3sajd1.
(The format of our PDB-style files is described here.)

Timeline for d3sajd1:

  • d3sajd1 first appeared in SCOPe 2.05, called d3sajd_